PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024671-RA_Salv
Common NameMYB104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family MYB
Protein Properties Length: 294aa    MW: 33941.7 Da    PI: 7.4298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024671-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-1798143147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg W + Ede+l+d+v  +G+ +W++Ia+++  gR++k+c++rw++ 
  SMil_00024671-RA_Salv  98 RGHWKPSEDEKLKDLVSAYGPQNWNLIAERLE-GRSGKSCRLRWYNQ 143
                            899*****************************.************96 PP

2Myb_DNA-binding58.31.8e-18150194147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++++T++E+e+l +a++ +G++ W++I+r ++ gRt++++k++w+ +
  SMil_00024671-RA_Salv 150 KKAFTEDEEERLMEAHRIYGNK-WALISRLFP-GRTDNSVKNHWHVL 194
                            679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.05593144IPR017930Myb domain
SMARTSM007172.2E-1597146IPR001005SANT/Myb domain
PfamPF002491.7E-1698144IPR001005SANT/Myb domain
SuperFamilySSF466892.06E-2898191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-2699151IPR009057Homeodomain-like
CDDcd001671.30E-13101142No hitNo description
PROSITE profilePS5129426.401145199IPR017930Myb domain
SMARTSM007172.4E-15149197IPR001005SANT/Myb domain
PfamPF002498.6E-16150194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-20152197IPR009057Homeodomain-like
CDDcd001672.23E-11152195No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MQQQQHHHIS RRHRENGGAS LIDRLLSPMF SLGFSANPPD QIILGFQSSN IHDREEEEEE  60
EEEEEEEEAT YKSFKKNGEN PNSSCKKREN RGTKFCARGH WKPSEDEKLK DLVSAYGPQN  120
WNLIAERLEG RSGKSCRLRW YNQLDPKINK KAFTEDEEER LMEAHRIYGN KWALISRLFP  180
GRTDNSVKNH WHVLMARRSR EKSKSYMKMK WACSKPPPLD HTKIPNYYYA SHSGYEHFIN  240
HAGNSYSPGS TSQRSFTAPI SSLTSAADHY QDAPCYVESV EAPTFIDFLG VGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33921981107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594580.0KF059458.1 Salvia miltiorrhiza MYB-related transcription factor (MYB104) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098643.18e-90PREDICTED: transcription factor MYB59-like isoform X2
TrEMBLA0A059PRF80.0A0A059PRF8_SALMI; MYB-related transcription factor
STRINGAT1G69560.18e-67(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-70myb domain protein 105
Publications ? help Back to Top
  1. Li C,Lu S
    Genome-wide characterization and comparative analysis of R2R3-MYB transcription factors shows the complexity of MYB-associated regulatory networks in Salvia miltiorrhiza.
    BMC Genomics, 2014. 15: p. 277
    [PMID:24725266]